Calpain 1 Rabbit mAb, Clone: [ARC1272], Unconjugated, Monoclonal

Catalog Number: MBL-CNA8710S
Article Name: Calpain 1 Rabbit mAb, Clone: [ARC1272], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA8710S
Supplier Catalog Number: CNA8710S
Alternative Catalog Number: MBL-CNA8710S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1272]
Molecular Weight: 82kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384).
Application Dilute: WB: WB,1:500 -1:1000|IF/ICC,1:50 -1:200