NR2E1/TLX Rabbit mAb, Clone: [ARC1295], Unconjugated, Monoclonal

Catalog Number: MBL-CNA8768S
Article Name: NR2E1/TLX Rabbit mAb, Clone: [ARC1295], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA8768S
Supplier Catalog Number: CNA8768S
Alternative Catalog Number: MBL-CNA8768S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NR2E1/TLX (Q9Y466).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1295]
Molecular Weight: 43kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIR
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NR2E1/TLX (Q9Y466).
Application Dilute: WB: WB,1:500 - 1:2000