DDT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8816T
Article Name: DDT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8816T
Supplier Catalog Number: CNA8816T
Alternative Catalog Number: MBL-CNA8816T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human DDT (NP_001346.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 13kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human DDT (NP_001346.1).
Application Dilute: WB: WB,1:200 - 1:2000