ARL8B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8869T
Article Name: ARL8B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8869T
Supplier Catalog Number: CNA8869T
Alternative Catalog Number: MBL-CNA8869T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 127-186 of human ARL8B (NP_060654.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 22kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 127-186 of human ARL8B (NP_060654.1).
Application Dilute: WB: WB,1:500 - 1:3000|IF/ICC,1:50 - 1:200