SNRPB2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA8908S
Article Name: SNRPB2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA8908S
Supplier Catalog Number: CNA8908S
Alternative Catalog Number: MBL-CNA8908S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SNRPB2 (NP_003083.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPN
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SNRPB2 (NP_003083.1).
Application Dilute: WB: WB,1:500 - 1:2000