LTA4H Rabbit mAb, Clone: [ARC1351], Unconjugated, Monoclonal

Catalog Number: MBL-CNA8918S
Article Name: LTA4H Rabbit mAb, Clone: [ARC1351], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA8918S
Supplier Catalog Number: CNA8918S
Alternative Catalog Number: MBL-CNA8918S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1351]
Molecular Weight: 69kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200