PDK1/PDHK1 Rabbit mAb, Clone: [ARC52376], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA8930P
| Article Name: |
PDK1/PDHK1 Rabbit mAb, Clone: [ARC52376], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA8930P |
| Supplier Catalog Number: |
CNA8930P |
| Alternative Catalog Number: |
MBL-CNA8930P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC52376] |
| Molecular Weight: |
49kDa |
| Buffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequence: |
STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1). |
| Application Dilute: |
WB: WB,1:2000 - 1:10000|IHC-P,1:100 - 1:500 |
