67kDa Laminin Receptor Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA9008T
Article Name: 67kDa Laminin Receptor Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA9008T
Supplier Catalog Number: CNA9008T
Alternative Catalog Number: MBL-CNA9008T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human 67kDa Laminin Receptor (NP_002286.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 33kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQV
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human 67kDa Laminin Receptor (NP_002286.2).
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200