Periostin Rabbit mAb, Clone: [ARC1380], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA9009S
| Article Name: |
Periostin Rabbit mAb, Clone: [ARC1380], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA9009S |
| Supplier Catalog Number: |
CNA9009S |
| Alternative Catalog Number: |
MBL-CNA9009S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Periostin (NP_001129406.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC1380] |
| Molecular Weight: |
80kDa/83kDa/84kDa/87kDa/90kDa/93kDa |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDH |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Periostin (NP_001129406.1). |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
