FKBP1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA9074T
Article Name: FKBP1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA9074T
Supplier Catalog Number: CNA9074T
Alternative Catalog Number: MBL-CNA9074T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP1B (NP_473374.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 12kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Target: A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP1B (NP_473374.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:20 - 1:50