EPB41L2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA9101T
Article Name: EPB41L2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA9101T
Supplier Catalog Number: CNA9101T
Alternative Catalog Number: MBL-CNA9101T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EPB41L2 (NP_001186317.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 113kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQK
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EPB41L2 (NP_001186317.1).
Application Dilute: WB: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200