PIM2 Rabbit mAb, Clone: [ARC2497], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9230S
Article Name: PIM2 Rabbit mAb, Clone: [ARC2497], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9230S
Supplier Catalog Number: CNA9230S
Alternative Catalog Number: MBL-CNA9230S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-120 of human PIM2 (NP_006866.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2497]
Molecular Weight: 34kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 10-120 of human PIM2 (NP_006866.2).
Application Dilute: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000