Nuclear Matrix Protein p84 (THOC1) Rabbit mAb, Clone: [ARC1504], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9269S
Article Name: Nuclear Matrix Protein p84 (THOC1) Rabbit mAb, Clone: [ARC1504], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9269S
Supplier Catalog Number: CNA9269S
Alternative Catalog Number: MBL-CNA9269S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1504]
Molecular Weight: 76kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: SLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNME
Target: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2).
Application Dilute: WB: WB,1:500 - 1:1000