PPM1E Rabbit mAb, Clone: [ARC2763], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9374S
Article Name: PPM1E Rabbit mAb, Clone: [ARC2763], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9374S
Supplier Catalog Number: CNA9374S
Alternative Catalog Number: MBL-CNA9374S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2763]
Molecular Weight: 84kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKA
Target: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54).
Application Dilute: WB: WB,1:500 - 1:1000