TAF15 Rabbit mAb, Clone: [ARC2765], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9383S
Article Name: TAF15 Rabbit mAb, Clone: [ARC2765], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9383S
Supplier Catalog Number: CNA9383S
Alternative Catalog Number: MBL-CNA9383S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2765]
Molecular Weight: 62kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
Target: A synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500