MYL12B Rabbit mAb, Clone: [ARC2712], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9387S
Article Name: MYL12B Rabbit mAb, Clone: [ARC2712], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9387S
Supplier Catalog Number: CNA9387S
Alternative Catalog Number: MBL-CNA9387S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 73-172 of human MYL12B (O14950).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2712]
Molecular Weight: 20kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Target: A synthetic peptide corresponding to a sequence within amino acids 73-172 of human MYL12B (O14950).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200