ADRA1A Rabbit mAb, Clone: [ARC2740], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9410S
Article Name: ADRA1A Rabbit mAb, Clone: [ARC2740], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9410S
Supplier Catalog Number: CNA9410S
Alternative Catalog Number: MBL-CNA9410S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ADRA1A (P35348).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2740]
Molecular Weight: 51kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: VWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMAS
Target: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ADRA1A (P35348).
Application Dilute: WB: WB,1:500 - 1:1000