ENPP5 Rabbit mAb, Clone: [ARC2780], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9415S
Article Name: ENPP5 Rabbit mAb, Clone: [ARC2780], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9415S
Supplier Catalog Number: CNA9415S
Alternative Catalog Number: MBL-CNA9415S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 378-477 of human ENPP5 (Q9UJA9).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2780]
Molecular Weight: 55kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: CHLLNITAMPHNGSFWNVQDLLNSAMPRVVPYTQSTILLPGSVKPAEYDQEGSYPYFIGVSLGSIIVIVFFVIFIKHLIHSQIPALQDMHAEIAQPLLQA
Target: A synthetic peptide corresponding to a sequence within amino acids 378-477 of human ENPP5 (Q9UJA9).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200