DEPDC6 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA9447T
Article Name: |
DEPDC6 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA9447T |
Supplier Catalog Number: |
CNA9447T |
Alternative Catalog Number: |
MBL-CNA9447T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-217 of human DEPDC6 (NP_073620.2). |
Conjugation: |
Unconjugated |
Clonality: |
Polyclonal |
Molecular Weight: |
46kDa |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQF |
Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-217 of human DEPDC6 (NP_073620.2). |
Application Dilute: |
WB: WB,1:500 - 1:2000 |