HIPK2 Rabbit mAb, Clone: [ARC1631], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9552S
Article Name: HIPK2 Rabbit mAb, Clone: [ARC1631], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9552S
Supplier Catalog Number: CNA9552S
Alternative Catalog Number: MBL-CNA9552S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HIPK2 (Q9H2X6).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1631]
Molecular Weight: 101KDa/128KDa/131kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: STSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYE
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HIPK2 (Q9H2X6).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200