CD7 Rabbit mAb, Clone: [ARC1634], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9560S
Article Name: CD7 Rabbit mAb, Clone: [ARC1634], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9560S
Supplier Catalog Number: CNA9560S
Alternative Catalog Number: MBL-CNA9560S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 141-240 of human CD7 (P09564).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1634]
Molecular Weight: 25kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Target: A synthetic peptide corresponding to a sequence within amino acids 141-240 of human CD7 (P09564).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:2000 - 1:10000