UBQLN2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA9568S
Article Name: UBQLN2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA9568S
Supplier Catalog Number: CNA9568S
Alternative Catalog Number: MBL-CNA9568S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UBQLN2 (NP_038472.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 66kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UBQLN2 (NP_038472.2).
Application Dilute: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200