PAX5 Rabbit mAb, Clone: [ARC1654], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9607S
Article Name: PAX5 Rabbit mAb, Clone: [ARC1654], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9607S
Supplier Catalog Number: CNA9607S
Alternative Catalog Number: MBL-CNA9607S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX5 (Q02548).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1654]
Molecular Weight: 42kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
Target: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX5 (Q02548).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IP,1:50 - 1:200