SF3B3/SAP130 Rabbit mAb, Clone: [ARC1667], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9624S
Article Name: SF3B3/SAP130 Rabbit mAb, Clone: [ARC1667], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9624S
Supplier Catalog Number: CNA9624S
Alternative Catalog Number: MBL-CNA9624S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1667]
Molecular Weight: 136kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: VLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200