Tbx3 Rabbit mAb, Clone: [ARC1677], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9646S
Article Name: Tbx3 Rabbit mAb, Clone: [ARC1677], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9646S
Supplier Catalog Number: CNA9646S
Alternative Catalog Number: MBL-CNA9646S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1677]
Molecular Weight: 79kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: SIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP
Target: A synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119).
Application Dilute: WB: WB,1:100 - 1:500