GSTK1 Rabbit mAb, Clone: [ARC1689], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9667S
Article Name: GSTK1 Rabbit mAb, Clone: [ARC1689], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9667S
Supplier Catalog Number: CNA9667S
Alternative Catalog Number: MBL-CNA9667S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GSTK1 (Q9Y2Q3).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1689]
Molecular Weight: 25kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAM
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GSTK1 (Q9Y2Q3).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200