RAP1A + RAP1B Rabbit mAb, Clone: [ARC1719], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9725S
Article Name: RAP1A + RAP1B Rabbit mAb, Clone: [ARC1719], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9725S
Supplier Catalog Number: CNA9725S
Alternative Catalog Number: MBL-CNA9725S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RAP1A + RAP1B (P61224).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1719]
Molecular Weight: 21kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS
Target: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RAP1A + RAP1B (P61224).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200