Alpha-2-Macroglobulin (A2M) Rabbit mAb, Clone: [ARC1734], Unconjugated, Monoclonal

Catalog Number: MBL-CNA9752S
Article Name: Alpha-2-Macroglobulin (A2M) Rabbit mAb, Clone: [ARC1734], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA9752S
Supplier Catalog Number: CNA9752S
Alternative Catalog Number: MBL-CNA9752S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Alpha-2-Macroglobulin (A2M) (P01023).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1734]
Molecular Weight: 163kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLL
Target: A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Alpha-2-Macroglobulin (A2M) (P01023).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200