OTC Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA9834S
Article Name: OTC Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA9834S
Supplier Catalog Number: CNA9834S
Alternative Catalog Number: MBL-CNA9834S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human OTC (NP_000522.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 40kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human OTC (NP_000522.3).
Application Dilute: WB: WB,1:1000 - 1:4000