PTK7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA9839S1
Article Name: PTK7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA9839S1
Supplier Catalog Number: CNA9839S1
Alternative Catalog Number: MBL-CNA9839S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 811-1070 of human PTK7 (NP_002812.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 118kDa
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: FLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 811-1070 of human PTK7 (NP_002812.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100