Phospho-VANGL2-S79/S82/S84 Rabbit mAb, Clone: [ARC5022], Unconjugated, Monoclonal
Catalog Number:
MBL-CNAP1207P
| Article Name: |
Phospho-VANGL2-S79/S82/S84 Rabbit mAb, Clone: [ARC5022], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNAP1207P |
| Supplier Catalog Number: |
CNAP1207P |
| Alternative Catalog Number: |
MBL-CNAP1207P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
A phospho specific peptide corresponding to residues surrounding S79/S82/S84 of human VANGL2 |
| Conjugation: |
Unconjugated |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC5022] |
| Molecular Weight: |
60kDa |
| Buffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequence: |
RDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDC |
| Target: |
A phospho specific peptide corresponding to residues surrounding S79/S82/S84 of human VANGL2 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
