Anti-SARS-CoV-2 ORF8 Antibody . Tested in ELISA applications. This antibody reacts with Human., Rabbit, Polyclonal
Catalog Number:
NBS-ABB-F48QC4-10
Article Name: |
Anti-SARS-CoV-2 ORF8 Antibody . Tested in ELISA applications. This antibody reacts with Human., Rabbit, Polyclonal |
Biozol Catalog Number: |
NBS-ABB-F48QC4-10 |
Supplier Catalog Number: |
ABB-F48QC4-10 |
Alternative Catalog Number: |
NBS-ABB-F48QC4-10 |
Manufacturer: |
Nordic BioSite |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ELISA |
Species Reactivity: |
Human |
Immunogen: |
AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
Anti-SARS-CoV-2 ORF8 Antibody . Tested in ELISA applications. This antibody reacts with Human. |
Clonality: |
Polyclonal |
Concentration: |
500 ug/ml |
NCBI: |
43740577 |
UniProt: |
P0DTC8 |
Target: |
8 |
Antibody Type: |
Primary Antibody |