Anti-SARS-CoV-2 ORF8 Antibody . Tested in ELISA applications. This antibody reacts with Human., Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SARS-CoV-2 ORF8 Antibody . Tested in ELISA applications. This antibody reacts with Human., Rabbit, Polyclonal
• Biozol Catalog Number: NBS-ABB-F48QC4-10
• Supplier Catalog Number: ABB-F48QC4-10
• Alternative Catalog Number: NBS-ABB-F48QC4-10
• Manufacturer: Nordic BioSite
• Host: Rabbit
• Category: Antikörper
• Application: ELISA
• Species Reactivity: Human
• Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Product Description

Anti-SARS-CoV-2 ORF8 Antibody . Tested in ELISA applications. This antibody reacts with Human.

Product Properties

• Clonality: Polyclonal
• Concentration: 500 ug/ml
• NCBI: 43740577
• UniProt: P0DTC8
• Target: 8
• Antibody Type: Primary Antibody