Anti-SARS-CoV-2 NSP9 Antibody . Tested in ELISA applications. This antibody reacts with Human., Rabbit, Polyclonal

Catalog Number: NBS-ABB-G12Z2J-10
Article Name: Anti-SARS-CoV-2 NSP9 Antibody . Tested in ELISA applications. This antibody reacts with Human., Rabbit, Polyclonal
Biozol Catalog Number: NBS-ABB-G12Z2J-10
Supplier Catalog Number: ABB-G12Z2J-10
Alternative Catalog Number: NBS-ABB-G12Z2J-10
Manufacturer: Nordic BioSite
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Anti-SARS-CoV-2 NSP9 Antibody . Tested in ELISA applications. This antibody reacts with Human.
Clonality: Polyclonal
Concentration: 500 ug/ml
NCBI: 43740578
UniProt: P0DTC1
Target: REP
Antibody Type: Primary Antibody