CD221, Bacteria

Catalog Number: NBS-BT-FPAWNK-1
Article Name: CD221, Bacteria
Biozol Catalog Number: NBS-BT-FPAWNK-1
Supplier Catalog Number: BT-FPAWNK-1
Alternative Catalog Number: NBS-BT-FPAWNK-1
Manufacturer: Nordic BioSite
Host: Bacteria
Category: Sonstiges
Type I insulin-like growth factor receptor (IGF-IR) is a transmembrane receptor tyrosine kinase that is widely expressed in many cell lines and cell types within fetal and postnatal tissues. Receptor autophosphorylation follows binding of the IGF-I and I
Concentration: 0.5mg/ml
Molecular Weight: ~25kDa
Tag: His-tag
UniProt: P08069
Buffer: PBS, 4M Urea, PH7.4
Source: bacteria
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: DVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYR IDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNG LILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPV FFYVQAKTGYENFIH