SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal

Product Overview

• Article Name: SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal
• Biozol Catalog Number: NBS-RBB-SOCSN6-100
• Supplier Catalog Number: RBB-SOCSN6-100
• Alternative Catalog Number: NBS-RBB-SOCSN6-100
• Manufacturer: Nordic BioSite
• Category: Antikörper
• Species Reactivity: Mouse
• Immunogen: 1-245aa
• Conjugation: Unconjugated
• Alternative Names: covid-19, sars-cov-2

Product Description

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If youre interested, plea

Product Properties

• Clonality: Monoclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Clone Designation: [5G4]
• Molecular Weight: 13.2KD
• Range: 31.2pg/ml-2000pg/ml
• Sensitivity: <10pg/ml
• NCBI: 7124
• UniProt: P01375
• Buffer: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
• Purity: >90%
• Form: Lyophilized
• Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ