SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal

Product Overview

• Article Name: SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal
• Biozol Catalog Number: NBS-RBB-VUK247-100
• Supplier Catalog Number: RBB-VUK247-100
• Alternative Catalog Number: NBS-RBB-VUK247-100
• Manufacturer: Nordic BioSite
• Category: Antikörper
• Species Reactivity: Mouse
• Immunogen: 1-245aa
• Conjugation: Unconjugated
• Alternative Names: covid-19, sars-cov-2

Product Description

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only. Product is under validation for additional applications and indications. If youre interested, please

Product Properties

• Clonality: Monoclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Clone Designation: [5G4]
• Molecular Weight: 22.7KD
• Range: 31.2pg/ml-2000pg/ml
• Sensitivity: <10pg/ml
• NCBI: 7124
• UniProt: P01375
• Buffer: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
• Purity: >90%
• Form: Lyophilized
• Sequence: AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ