Kv1.2 K+ channel
Catalog Number:
NRM-MO50016
- Images (0)
| Article Name: | Kv1.2 K+ channel |
| Biozol Catalog Number: | NRM-MO50016 |
| Supplier Catalog Number: | MO50016 |
| Alternative Catalog Number: | NRM-MO50016-100,NRM-MO50016 |
| Manufacturer: | Neuromics |
| Category: | Proteine/Peptide |
| Application: | ICC, IHC, IP, WB |
| Species Reactivity: | Zebrafish, Human, Rat, Mouse, Xenopus |
| Immunogen: | Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or |
Product Guarantee and Expert Support
