SARS-CoV-2 Antibody (ORF3a), Rabbit, Polyclonal

Catalog Number: NSJ-RQ6295
Article Name: SARS-CoV-2 Antibody (ORF3a), Rabbit, Polyclonal
Biozol Catalog Number: NSJ-RQ6295
Supplier Catalog Number: RQ6295
Alternative Catalog Number: NSJ-RQ6295
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: Amino acids MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASggggFQSASKIITLKKRWQLALSKGVHFVCNLggggQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYC
IPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL w
Alternative Names: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for i
Clonality: Polyclonal
Concentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Isotype: Rabbit IgG
UniProt: P0DTC3
Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Purity: Affinity purified
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Target: SARS-CoV-2
Antibody Type: Primary Antibody
Application Dilute: ELISA
Application Notes: Optimal dilution of the SARS-CoV-2 ORF3a antibody should be determined by the researcher.