SARS-CoV-2 Antibody (NSP14 / Exonuclease), Rabbit, Polyclonal

Product Overview

• Article Name: SARS-CoV-2 Antibody (NSP14 / Exonuclease), Rabbit, Polyclonal
• Biozol Catalog Number: NSJ-RQ6308
• Supplier Catalog Number: RQ6308
• Alternative Catalog Number: NSJ-RQ6308
• Manufacturer: NSJ Bioreagents
• Host: Rabbit
• Category: Antikörper
• Application: ELISA
• Species Reactivity: Human
• Immunogen: Amino acids AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLggggN; CNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYN; MMISAGF
• Alternative Names: sars-cov-2

Product Description

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for i

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Isotype: Rabbit IgG
• UniProt: P0DTD1
• Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Purity: Affinity purified
• Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Target: SARS-CoV-2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: ELISA
• Application Notes: Optimal dilution of the SARS-CoV-2 Exonuclease antibody should be determined by the researcher.