Transferrin Antibody / TF, Clone: [7I11B10], Mouse, Monoclonal

Product Overview

• Article Name: Transferrin Antibody / TF, Clone: [7I11B10], Mouse, Monoclonal
• Biozol Catalog Number: NSJ-RQ7657
• Supplier Catalog Number: RQ7657
• Alternative Catalog Number: NSJ-RQ7657
• Manufacturer: NSJ Bioreagents
• Host: Mouse
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Amino acids 20-49 (VPDKTVRWCAVSEHEATKCQSFRDHMKSVI) from the human protein were used as the immunogen for the Transferrin antibody.

Product Description

Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is c

Product Properties

• Clonality: Monoclonal
• Clone Designation: [7I11B10]
• UniProt: P02787
• Buffer: Lyophilized from 1X PBS with 2% Trehalose
• Purity: Antigen affinity purified
• Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: Western blot: 0.5-1ug/ml
• Application Notes: Optimal dilution of the Transferrin antibody should be determined by the researcher.