AGER Antibody / RAGE, Clone: [5C6C1], Mouse, Monoclonal

Product Overview

• Article Name: AGER Antibody / RAGE, Clone: [5C6C1], Mouse, Monoclonal
• Biozol Catalog Number: NSJ-RQ7676
• Supplier Catalog Number: RQ7676
• Alternative Catalog Number: NSJ-RQ7676
• Manufacturer: NSJ Bioreagents
• Host: Mouse
• Category: Antikörper
• Application: FACS, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Amino acids 91-120 (IQDEGIFRCQAMNRNGKETKSNYRVRVYQI) from the human protein were used as the immunogen for the AGER antibody.

Product Description

The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseas

Product Properties

• Clonality: Monoclonal
• Clone Designation: [5C6C1]
• UniProt: Q15109
• Buffer: Lyophilized from 1X PBS with 2% Trehalose
• Purity: Antigen affinity purified
• Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
• Application Notes: Optimal dilution of the AGER antibody should be determined by the researcher.