[beta]-Amyloid (11- 40)

Catalog Number: PEL-EP10013_5
Article Name: [beta]-Amyloid (11- 40)
Biozol Catalog Number: PEL-EP10013_5
Supplier Catalog Number: EP10013_5
Alternative Catalog Number: PEL-EP10013_5
Manufacturer: peptides and elephants
Category: Proteine/Peptide
Species Reactivity: Human
Post-mortem Alzheimers diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading t
Purity: 95%
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV