[beta]-Amyloid (1-40)

Catalog Number: PEL-EP10059_1
Article Name: [beta]-Amyloid (1-40)
Biozol Catalog Number: PEL-EP10059_1
Supplier Catalog Number: EP10059_1
Alternative Catalog Number: PEL-EP10059_1
Manufacturer: peptides and elephants
Category: Proteine/Peptide
Species Reactivity: Rat
A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimers disease. The length of the C-terminus is a critical determinant
Purity: 95%
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV