LL - 37

Product Overview

• Article Name: LL - 37
• Biozol Catalog Number: PEL-EP11651_1
• Supplier Catalog Number: EP11651_1
• Alternative Catalog Number: PEL-EP11651_1
• Manufacturer: peptides and elephants
• Category: Proteine/Peptide

Product Description

The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,i belongsi to the cathelicidin family of peptides, and this peptide corresponds to the sequence

Product Properties

• Purity: 95%
• Sequence: [LL-37, 37 aa]