LL - 37

Catalog Number: PEL-EP11651_5
Article Name: LL - 37
Biozol Catalog Number: PEL-EP11651_5
Supplier Catalog Number: EP11651_5
Alternative Catalog Number: PEL-EP11651_5
Manufacturer: peptides and elephants
Category: Proteine/Peptide
Alternative Names: other name: Baculoviral IAP repeat-containing protein 7 (280-289), ML-IAP 280-289
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,i belongsi to the cathelicidin family of peptides, and this peptide corresponds to the sequence
Purity: 95%
Sequence: [LL-37, 37 aa]