SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
PRS-11-048
| Article Name: |
SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
PRS-11-048 |
| Supplier Catalog Number: |
11-048 |
| Alternative Catalog Number: |
PRS-11-048-0.1 |
| Manufacturer: |
ProSci |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA |
| Species Reactivity: |
Virus |
| Immunogen: |
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Accessory protein 7a, ORF7a protein, Protein U122, Protein X4, covid-19, sars-cov-2 |
| Clonality: |
Polyclonal |
| Concentration: |
batch dependent |
| Buffer: |
PBS, pH7.4, containing 0.05% proclin300, 50% glycerol. |
| Form: |
Liquid |
| Application Dilute: |
Optimal dilutions for each application to be determined by the researcher. |
| Application Notes: |
Elisa:1:4000~1:8000 |
