SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: PRS-11-048
Article Name: SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: PRS-11-048
Supplier Catalog Number: 11-048
Alternative Catalog Number: PRS-11-048-0.1
Manufacturer: ProSci
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Virus
Immunogen: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
Conjugation: Unconjugated
Alternative Names: Accessory protein 7a, ORF7a protein, Protein U122, Protein X4, covid-19, sars-cov-2
Clonality: Polyclonal
Concentration: batch dependent
Buffer: PBS, pH7.4, containing 0.05% proclin300, 50% glycerol.
Form: Liquid
Application Dilute: Optimal dilutions for each application to be determined by the researcher.
Application Notes: Elisa:1:4000~1:8000