Recombinant Human CCL5

Catalog Number: QBS-50181P-1000
Article Name: Recombinant Human CCL5
Biozol Catalog Number: QBS-50181P-1000
Supplier Catalog Number: 50181P-1000
Alternative Catalog Number: QBS-50181P-1000-1000
Manufacturer: QED Bioscience
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: rHuCCL5
Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91
Concentration: Lot Specific
Molecular Weight: 7.851 kDa
UniProt: P13501
Source: Recombinant human CCL5, produced in E. coli
Purity: >97%
Form: Lyophilized.
Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS
Target: CCL5
Antibody Type: Recombinant Antibody
Application Dilute: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.