Recombinant Human CCL5
Catalog Number:
QBS-50181P-5
Article Name: |
Recombinant Human CCL5 |
Biozol Catalog Number: |
QBS-50181P-5 |
Supplier Catalog Number: |
50181P-5 |
Alternative Catalog Number: |
QBS-50181P-5-5 |
Manufacturer: |
QED Bioscience |
Category: |
Proteine/Peptide |
Species Reactivity: |
Human |
Alternative Names: |
rHuCCL5 |
Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91 |
Concentration: |
Lot Specific |
Molecular Weight: |
7.851 kDa |
UniProt: |
P13501 |
Source: |
Recombinant human CCL5, produced in E. coli |
Purity: |
>97% |
Form: |
Lyophilized. |
Sequence: |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS |
Target: |
CCL5 |
Antibody Type: |
Recombinant Antibody |
Application Dilute: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |