Recombinant Human CCL5, biotinylated, Biotin

Catalog Number: QBS-50181PB-10
Article Name: Recombinant Human CCL5, biotinylated, Biotin
Biozol Catalog Number: QBS-50181PB-10
Supplier Catalog Number: 50181PB-10
Alternative Catalog Number: QBS-50181PB-10-10
Manufacturer: QED Bioscience
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Biotin
Alternative Names: rHuCCL5-biotin, Rantes
Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91
Concentration: Lot Specific
UniProt: P13501
Source: Recombinant human CCL5, produced in E. coli
Purity: >97% by SDS-PAGE
Form: Lyophilized.
Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS
Target: CCL5ylated
Antibody Type: Recombinant Antibody
Application Dilute: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.