Recombinant Human CCL5, biotinylated, Biotin
Catalog Number:
QBS-50181PB-2
| Article Name: |
Recombinant Human CCL5, biotinylated, Biotin |
| Biozol Catalog Number: |
QBS-50181PB-2 |
| Supplier Catalog Number: |
50181PB-2 |
| Alternative Catalog Number: |
QBS-50181PB-2-2 |
| Manufacturer: |
QED Bioscience |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Human |
| Conjugation: |
Biotin |
| Alternative Names: |
rHuCCL5-biotin, Rantes |
| Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91 |
| Concentration: |
Lot Specific |
| UniProt: |
P13501 |
| Source: |
Recombinant human CCL5, produced in E. coli |
| Purity: |
>97% by SDS-PAGE |
| Form: |
Lyophilized. |
| Sequence: |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS |
| Target: |
CCL5ylated |
| Antibody Type: |
Recombinant Antibody |
| Application Dilute: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |
